PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo22G0043700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 458aa    MW: 49753.6 Da    PI: 5.36
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo22G0043700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.5e-18107153148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WTteEd ll ++vkq+G ++W+ Ia+++  gR +kqc++rw+++l
  Spipo22G0043700 107 KGQWTTEEDSLLSNLVKQHGLRRWSHIAKKLA-GRMGKQCRERWHNHL 153
                      799*****************************.*************97 PP

2Myb_DNA-binding56.94.7e-18159201145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eE+ llv+a+++ G++ W+ I+++++ gRt++++k++w+
  Spipo22G0043700 159 KDTWSEEEERLLVEAHEKVGNR-WAEISKMIP-GRTENSIKNHWN 201
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.422102157IPR017930Myb domain
SuperFamilySSF466896.83E-30104200IPR009057Homeodomain-like
SMARTSM007171.1E-16106155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-27108159IPR009057Homeodomain-like
CDDcd001674.33E-16110153No hitNo description
PfamPF139214.0E-18110170No hitNo description
PROSITE profilePS5129420.923158208IPR017930Myb domain
SMARTSM007176.3E-18158206IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-20160206IPR009057Homeodomain-like
CDDcd001671.25E-14161204No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MLLSSSGGAE MQRPRDPDLP PAPPNGDEPA IALPRNHPLL PPCAIGAVPS GMLLDETPFL  60
CGFLLWGGVG PSSVSGFTDG GLLQADEGLV EGRNRGARAY PEARLVKGQW TTEEDSLLSN  120
LVKQHGLRRW SHIAKKLAGR MGKQCRERWH NHLRPDIKKD TWSEEEERLL VEAHEKVGNR  180
WAEISKMIPG RTENSIKNHW NATKRRQNAR RTTKGKAGGG PKPTILQEYI RRLILTEAGD  240
TVDPTAAAAT LTAGPRSHHL LPSRPDRPTS AIDSSASTLT VFPPEGDALL SQDLFMYYSY  300
ALRMEGVTAP DESFDESDIL RGGLPSEEPS YACDYYYDDG VVLPFLDVDR CGAVLGSFGG  360
CDDHCDEAVT GASYYCSRTS SGSSEVTATS RAPLISSDIP RLQEISQTGT PSADDACGGW  420
DWSCSRGDLD LMEMIGRGGD DRCRRATPDH LERGPRG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-461052072104C-Myb DNA-Binding Domain
1msf_C1e-461052072104C-Myb DNA-Binding Domain
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010923245.14e-71PREDICTED: uncharacterized protein LOC105046375
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-45myb domain protein 98